Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neosartorya fumigata Protein sym1(sym1)

Recombinant Neosartorya fumigata Protein sym1(sym1)

SKU:CSB-CF681222NGS

Regular price $1,801.00 USD
Regular price Sale price $1,801.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)

Uniprot NO.:Q4WDZ0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFQWYQRSLIQRPLLTQSLTTACLFAVGDSLAQQAVEKRGIAQHDVARTGRMAFYGGGNV QPFPYKLPLLTVVAVFGPLATKWFQVLQRRINLPSAQRTVVGRVAADQLLFAPTMIGVFL SSMSVLEGGSLSEKLERSYWPALKANWTVWPFLQLVNFALVPLQFRVLTVNVLNIGWNCF LSLSNNVGSQDVPLVA

Protein Names:Recommended name: Protein sym1

Gene Names:Name:sym1 ORF Names:AFUA_5G01170

Expression Region:1-196

Sequence Info:full length protein

View full details