Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neosartorya fumigata Probable glycosidase crf1(crf1),partial

Recombinant Neosartorya fumigata Probable glycosidase crf1(crf1),partial

SKU:CSB-EP818279NGS1

Regular price $1,002.00 USD
Regular price Sale price $1,002.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Metabolism

Uniprot ID:Q8J0P4

Gene Names:crf1

Organism:Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)

AA Sequence:TYTADFTSASALDQWEVTAGKVPVGPQGAEFTVAKQGDAPTIDTDFYFFFGKAEVVMKAAPGTGVVSSIVLESDDLDEVDWEVLGGDTTQVQTNYFGKGDTTTYDRGTYVPVATPQETFHTYTIDWTKDAVTWSIDGAVVRTLTYNDAKGGTRFPQTPMRLRLGSWAGGDPSNPKGTIEWAGGLTDYSAGPY

Expression Region:42-233aa

Sequence Info:Partial

Source:E.coli

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:28.1 kDa

Alternative Name(s):Crh-like protein 1 (Allergen: Asp f 9)

Relevance:

Reference:"Structures of the glycosylphosphatidylinositol membrane anchors from Aspergillus fumigatus membrane proteins." Fontaine T., Magnin T., Melhert A., Lamont D., Latge J.-P., Ferguson M.A.J. Glycobiology 13:169-177(2003)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:Cell membrane, Lipid-anchor, GPI-anchor, Secreted, cell wall

Protein Families:Glycosyl hydrolase 16 family, CRH1 subfamily

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?afm:AFUA_1G16190

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details