Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neisseria meningitidis serogroup B Probable intracellular septation protein A (NMB0342)

Recombinant Neisseria meningitidis serogroup B Probable intracellular septation protein A (NMB0342)

SKU:CSB-CF353880NGG

Regular price $1,775.00 USD
Regular price Sale price $1,775.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neisseria meningitidis serogroup B (strain MC58)

Uniprot NO.:P65196

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKFVSDLLSVILFFATYTVTKNMIAATAVALVAGVVQAAFLYWKYKKLDTMQWVGLVLIV VFGGATIVLGDSRFIMWKPSVLFWLGALFLWGSHLAGKNGLKASIGREIQLPDAVWAKLT YMWVGFLIFMGIANWFVFTRFESQWVNYKMFGSTALMLVFFIIQGIYLSTCLKKED

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:NMB0342

Expression Region:1-176

Sequence Info:full length protein

View full details