Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neisseria meningitidis serogroup A - serotype 4A UPF0059 membrane protein NMA0052(NMA0052)

Recombinant Neisseria meningitidis serogroup A - serotype 4A UPF0059 membrane protein NMA0052(NMA0052)

SKU:CSB-CF878172NGF

Regular price $1,857.00 USD
Regular price Sale price $1,857.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

Uniprot NO.:Q9JX59

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGFYALLLIALGMSMDAFAVALAKGAAVRMPPRKIAATALVFGSVEALTPLAGWVGGFYA KPFISEWDHWAAFVLLGGLGLKMMREGLSGKAEDVRESKRESLWMTVLTAFGTSIDSMIV GVGLAFMEVNIAFAAAIIGMATTVMVAVGLAAGGALGGLFGKRAEFAGGLVLIAIGTWTL LSHLGLIG

Protein Names:Recommended name: UPF0059 membrane protein NMA0052

Gene Names:Ordered Locus Names:NMA0052

Expression Region:1-188

Sequence Info:full length protein

View full details