Skip to product information
1 of 1

Gene Bio Systems

Recombinant Neisseria gonorrhoeae UPF0070 protein NGO0425 (NGO0425)

Recombinant Neisseria gonorrhoeae UPF0070 protein NGO0425 (NGO0425)

SKU:CSB-CF528335NGA

Regular price $1,816.00 USD
Regular price Sale price $1,816.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)

Uniprot NO.:O87406

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAAHLEEQQELDNFKYFWKTTGKWLFALLILAALGYLGYTVYQNRAASQNQEAAAVLANI VEKAQNKAPQSEINAELSKLQQSYPHSISAAQATLMAAATEFDAQRYDVAEGHLKWVLSN QKDSLIQALAAQRLGVVLLQQKKYDAALAALDTPVEADFAPLLMETKGDVYAAQEKSQEA LKNYGQALEKMPQDSVGRELLQMKLDSLK

Protein Names:Recommended name: UPF0070 protein NGO0425 Alternative name(s): ORF2

Gene Names:Ordered Locus Names:NGO0425

Expression Region:1-209

Sequence Info:full length protein

View full details