Skip to product information
1 of 1

Gene Bio Systems

Recombinant Natronomonas pharaonis UPF0290 protein NP0990A(NP0990A)

Recombinant Natronomonas pharaonis UPF0290 protein NP0990A(NP0990A)

SKU:CSB-CF661757NAAJ

Regular price $1,791.00 USD
Regular price Sale price $1,791.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Natronomonas pharaonis (strain DSM 2160 / ATCC 35678)

Uniprot NO.:Q3ITE8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVAETVAIAVWAMLPAYVPNNVAVLAGGGRPIDGGRTLDKLTDEDGVLYDENRILGDGKT WRGTAFGTAAGVVLALLLNQLQPFVAGTVGVPQFPIAAAVALAFGAMLGDILASFLKRRT GRQRGAAFPGVDQLDFVIVSLALTAIVATGWFLATFTLPVLVAIFVLTPVLHVSTNGLAY AFGLKDEPW

Protein Names:Recommended name: UPF0290 protein NP0990A

Gene Names:Ordered Locus Names:NP0990A

Expression Region:1-189

Sequence Info:full length protein

View full details