Gene Bio Systems
Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_272(MPN_272)
Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_272(MPN_272)
SKU:CSB-CF875384MLW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Uniprot NO.:Q9EXD2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNRPTPNFEAIDKKISAFVTNHDNLLDKLLKQQTELLTSEITTNFEVTQQIQEEVAKKTK QHSKNYKWLVTVVLANGVVSLFLLGGLIYLFSK
Protein Names:Recommended name: Uncharacterized protein MPN_272
Gene Names:Ordered Locus Names:MPN_272 ORF Names:A65_orf94, MP562.1
Expression Region:1-93
Sequence Info:full length protein
