Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG055 homolog (MPN_068)

Recombinant Mycoplasma pneumoniae Uncharacterized protein MG055 homolog (MPN_068)

SKU:CSB-CF303372MLW

Regular price $1,749.00 USD
Regular price Sale price $1,749.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycoplasma pneumoniae (strain ATCC 29342 / M129)

Uniprot NO.:P75048

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEKKKLPFGLKNKEKLTAYNDEKIHELHRQLKAKIEAKKAKEKQDSKTKDTDKKVDQTPK VKVPFTKKFSNLWFGIDKEVNKIVWVTSKKLITIFLLIVLVSAIMIGIYFGINHLFIALG VFKGK

Protein Names:Recommended name: Uncharacterized protein MG055 homolog

Gene Names:Ordered Locus Names:MPN_068 ORF Names:D09_orf125, MP086

Expression Region:1-125

Sequence Info:full length protein

View full details