Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycoplasma pneumoniae Uncharacterized lipoprotein MPN_083(MPN_083),partial

Recombinant Mycoplasma pneumoniae Uncharacterized lipoprotein MPN_083(MPN_083),partial

SKU:CSB-EP303444MLW

Regular price $1,243.00 USD
Regular price Sale price $1,243.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Microbiology

Uniprot ID: P75610

Gene Names: MPN_083

Organism: Mycoplasma pneumoniae (strain ATCC 29342 / M129)

AA Sequence: CSFKDYIPTPSFRKDFSTENNFVKNKVPGKDDIYSKFYDLTFSLNFVNNQAQEFGTGWLIDWKGDENKNLSKNKEGQTASQTRSSSEQTTDQDANLFTAYIATNLHVADGLKNDQDYAPYNKDGWGQPYPYQQKTQSFLLGKYTKPNVQLVKTNYEKPEDAVIEQKLKEDSLLFIQTSTLPKTAYAAIDPVNFSYNPTRTNGFWTAGKYNVYNGGNSIGNY

Expression Region: 22-242aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 41.2 kDa

Alternative Name(s): Uncharacterized lipoprotein MPN_083

Relevance:

Reference: "Complete sequence analysis of the genome of the bacterium Mycoplasma pneumoniae."Himmelreich R., Hilbert H., Plagens H., Pirkl E., Li B.-C., Herrmann R.Nucleic Acids Res. 24:4420-4449(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details