Recombinant Mycoplasma genitalium  Uncharacterized protein MG406(MG406)

Recombinant Mycoplasma genitalium Uncharacterized protein MG406(MG406)

CSB-CF669842MLN
Regular price
$1,082.00 USD
Sale price
$1,082.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)

Uniprot NO.:Q49431

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLPLPFAVLNSLSVLRLASFFASLKNVKKQKAVSFFAFFFTARYLIYLIPVIISFVVTPS IFNTIATIISTLFFPILNLVLSFVWLPLEYFFINLISKSKRKHVATGDSFKRN

Protein Names:Recommended name: Uncharacterized protein MG406

Gene Names:Ordered Locus Names:MG406

Expression Region:1-113

Sequence Info:full length protein