Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycoplasma genitalium Uncharacterized protein MG028 (MG028)

Recombinant Mycoplasma genitalium Uncharacterized protein MG028 (MG028)

SKU:CSB-CF342473MLN

Regular price $1,807.00 USD
Regular price Sale price $1,807.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)

Uniprot NO.:P47274

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKRNWRQHYNVFLANLVLVFGFALNILVAKQSLNNTTPQFRFLFVTPFLGVVIGAVLYFF DVKWFLIDYPYKKFHFQKKWAIVYLSGVIVFFLNVLIGVVLLVVMVNYITNQILEREYER LFTNSLPYLWSTTGTSIVLSLISIGMSKTAHFFIDIEILKAKKGEPTDPNKTDNRAVVIN LDENKKNEKEQSPPSAEMTSL

Protein Names:Recommended name: Uncharacterized protein MG028

Gene Names:Ordered Locus Names:MG028

Expression Region:1-201

Sequence Info:full length protein

View full details