Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycobacterium tuberculosis Recombination protein RecR(recR)

Recombinant Mycobacterium tuberculosis Recombination protein RecR(recR)

SKU:CSB-EP402913MON

Regular price $1,133.00 USD
Regular price Sale price $1,133.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: A5U941

Gene Names: recR

Organism: Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

AA Sequence: MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCGNVSDNERCRICSDIRRDASVVCIVEEPKDIQAVERTREFRGRYHVLGGALDPLSGIGPDQLRIRELLSRIGERVDDVDVTEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPMGGDLEFADELTLGRALAGRRVLA

Expression Region: 1-203aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 26.1 kDa

Alternative Name(s):

Relevance: May play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO.

Reference: "Genetic basis of virulence attenuation revealed by comparative genomic analysis of Mycobacterium tuberculosis strain H37Ra versus H37Rv." Zheng H., Lu L., Wang B., Pu S., Zhang X., Zhu G., Shi W., Zhang L., Wang H., Wang S., Zhao G., Zhang Y. PLoS ONE 3:E2375-E2375(2008)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details