Recombinant Mycobacterium tuberculosis MPT51-MPB51 antigen(mpt51)

Recombinant Mycobacterium tuberculosis MPT51-MPB51 antigen(mpt51)

CSB-EP363615MVZ
Regular price
$803.00 USD
Sale price
$803.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Others

Target / Protein: mpt51

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Delivery time: 3-7 business days

Uniprot ID: P9WQN6

AA Sequence: AEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 27-299aa

Protein length: Full Length of Mature Protein

MW: 44.5 kDa

Alternative Name(s):

Relevance: May have a role in host tissue attachment, whereby ligands may include the serum protein fibronectin and small sugars.

Reference: "Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains."Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O., Peterson J.D., DeBoy R.T., Dodson R.J., Gwinn M.L., Haft D.H., Hickey E.K., Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M.D., Salzberg S.L., Delcher A., Utterback T.R. Fraser C.M.J. Bacteriol. 184:5479-5490(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share