Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64(mpt64)

Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64(mpt64)

CSB-BP358713MVZb0
Regular price
$482.00 USD
Sale price
$482.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P9WIN8

Gene Names: mpt64

Organism: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

AA Sequence: APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA

Expression Region: 24-228aa

Sequence Info: Full Length of Mature Protein

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged

MW: 24.5 kDa

Alternative Name(s): Antigen MPT64

Relevance:

Reference: "Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains." Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O., Peterson J.D., DeBoy R.T., Dodson R.J., Gwinn M.L., Haft D.H., Hickey E.K., Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M.D., Salzberg S.L., Delcher A., Utterback T.R. Fraser C.M. J. Bacteriol. 184:5479-5490(2002)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share