Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycobacterium sp. UPF0233 membrane protein Mjls_0012 (Mjls_0012)

Recombinant Mycobacterium sp. UPF0233 membrane protein Mjls_0012 (Mjls_0012)

SKU:CSB-CF388257MOL

Regular price $1,674.00 USD
Regular price Sale price $1,674.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium sp. (strain JLS)

Uniprot NO.:A3PSE8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPKSKVRKKNDFTISPVSRTPVKVKAGPSSVWFVALFVGLMLIGLIWLLVFQLAATNPVD APGMLQWMADLGPWNYAIAFAFMITGLLLTMRWR

Protein Names:Recommended name: UPF0233 membrane protein Mjls_0012

Gene Names:Ordered Locus Names:Mjls_0012

Expression Region:1-94

Sequence Info:full length protein

View full details