Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mycobacterium gilvum UPF0060 membrane protein Mflv_3127 (Mflv_3127)

Recombinant Mycobacterium gilvum UPF0060 membrane protein Mflv_3127 (Mflv_3127)

SKU:CSB-CF392814MOK

Regular price $1,691.00 USD
Regular price Sale price $1,691.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium gilvum (strain PYR-GCK) (Mycobacterium flavescens (strain ATCC 700033 / PYR-GCK))

Uniprot NO.:A4TB05

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVVKSALLFVLAAVLEIGGAWLVWQGFREHRGWLWVGAGVLALGAYGFVAAFQPDANFGR VLAAYGGVFVAGSLIWGMVADGFRPDRWDITGAAVCLLGVVLIMYAPR

Protein Names:Recommended name: UPF0060 membrane protein Mflv_3127

Gene Names:Ordered Locus Names:Mflv_3127

Expression Region:1-108

Sequence Info:full length protein

View full details