Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Vitamin K epoxide reductase complex subunit 1(Vkorc1)

Recombinant Mouse Vitamin K epoxide reductase complex subunit 1(Vkorc1)

SKU:CSB-CF871901MO

Regular price $1,754.00 USD
Regular price Sale price $1,754.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9CRC0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGTTWRSPGLVRLALCLAGLALSLYALHVKAARARDENYRALCDVGTAISCSRVFSSRWG RGFGLVEHMLGADSVLNQSNSIFGCLFYTLQLLLGCLRGRWASILLVLSSLVSVAGSVYL AWILFFVLYDFCIVCITTYAINVGLMLLSFQKVPEHKTKKH

Protein Names:Recommended name: Vitamin K epoxide reductase complex subunit 1 EC= 1.1.4.1 Alternative name(s): Vitamin K1 2,3-epoxide reductase subunit 1

Gene Names:Name:Vkorc1

Expression Region:1-161

Sequence Info:full length protein

View full details