Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Vesicle-trafficking protein SEC22b(Sec22b)

Recombinant Mouse Vesicle-trafficking protein SEC22b(Sec22b)

SKU:CSB-CF020945MO

Regular price $1,875.00 USD
Regular price Sale price $1,875.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O08547

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL

Protein Names:Recommended name: Vesicle-trafficking protein SEC22b Alternative name(s): ER-Golgi SNARE of 24 kDa Short name= ERS-24 Short name= ERS24 SEC22 vesicle-trafficking protein homolog B SEC22 vesicle-trafficking protein-like 1 Short name= mSec22b

Gene Names:Name:Sec22b Synonyms:Sec22l1

Expression Region:2-215

Sequence Info:full length protein

View full details