Gene Bio Systems
Recombinant Mouse V-type proton ATPase 16 kDa proteolipid subunit(Atp6v0c)
Recombinant Mouse V-type proton ATPase 16 kDa proteolipid subunit(Atp6v0c)
SKU:CSB-CF002389MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:P63082
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MADIKNNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVV MAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG TAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Protein Names:Recommended name: V-type proton ATPase 16 kDa proteolipid subunit Short name= V-ATPase 16 kDa proteolipid subunit Alternative name(s): PL16 Vacuolar proton pump 16 kDa proteolipid subunit
Gene Names:Name:Atp6v0c Synonyms:Atp6c, Atp6l, Atpl, Mvp
Expression Region:1-155
Sequence Info:Full length protein
