
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q9CZL2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MCSARKLLRGGAGSAGGECDEDGAAPAGRVEEPEHGASPRRRRPQDEGEQDIEEPQNHSG EPIGDDYKKMGTLFGELNKNLLNMGFTRMYFGERIVEPVVVLFFWLMLWFLGLQALGLVA VLCLVIIYVQQ
Protein Names:Recommended name: Uncharacterized protein C4orf32 homolog
Gene Names:
Expression Region:1-131
Sequence Info:full length protein
You may also like
-
Recombinant Mouse Uncharacterized protein C4orf3 homolog
- Regular price
- $1,206.00 USD
- Sale price
- $1,206.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Uncharacterized protein C4orf34 homolog
- Regular price
- $1,236.00 USD
- Sale price
- $1,236.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Uncharacterized protein C4orf32(C4orf32)
- Regular price
- $1,266.00 USD
- Sale price
- $1,266.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Uncharacterized protein C3orf18 homolog
- Regular price
- $1,296.00 USD
- Sale price
- $1,296.00 USD
- Regular price
-
- Unit price
- per
Sold out