Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse TYRO protein tyrosine kinase-binding protein(Tyrobp)

Recombinant Mouse TYRO protein tyrosine kinase-binding protein(Tyrobp)

SKU:CSB-CF025398MO

Regular price $1,670.00 USD
Regular price Sale price $1,670.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O54885

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LSPVQAQSDTFPRCDCSSVSPGVLAGIVLGDLVLTLLIALAVYSLGRLVSRGQGTAEGTRKQHIAETESPYQELQGQRPEVYSDLNTQRQYYR

Protein Names:Recommended name: TYRO protein tyrosine kinase-binding protein Alternative name(s): DNAX-activation protein 12 Killer-activating receptor-associated protein Short name= KAR-associated protein

Gene Names:Name:Tyrobp Synonyms:Dap12, Karap

Expression Region:22-114

Sequence Info:full length protein

View full details