Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Tumor necrosis factor receptor superfamily member 9(Tnfrsf9)

Recombinant Mouse Tumor necrosis factor receptor superfamily member 9(Tnfrsf9)

SKU:CSB-CF023984MO

Regular price $1,844.00 USD
Regular price Sale price $1,844.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P20334

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLTLFLALTSALLLALIFITLLFSVLKWIRKKFPHIFKQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL

Protein Names:Recommended name: Tumor necrosis factor receptor superfamily member 9 Alternative name(s): 4-1BB ligand receptor T-cell antigen 4-1BB CD_antigen= CD137

Gene Names:Name:Tnfrsf9 Synonyms:Cd137, Ila, Ly63

Expression Region:24-256

Sequence Info:full length protein

View full details