Skip to product information
1 of 1

GeneBio Systems

Recombinant Mouse Tumor necrosis factor receptor superfamily member 3 (Ltbr), partial (Active)

Recombinant Mouse Tumor necrosis factor receptor superfamily member 3 (Ltbr), partial (Active)

SKU:P50284

Regular price $540.00 USD
Regular price Sale price $540.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Cell Biology

Uniprot ID: P50284

Gene Names: Ltbr

Alternative Name(s): Lymphotoxin-beta receptor

Abbreviation: Recombinant Mouse Ltbr protein, partial (Active)

Organism: Mus musculus (Mouse)

Source: Mammalian cell

Expression Region: 31-223aa

Protein Length: Partial

Tag Info: C-terminal 10xHis-tagged

Target Protein Sequence: QLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEFVFAVCSRSQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCTSDRKAECRCQPGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDVNCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPEPGAMLL

MW: 23.1 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Ltbr at 2 μg/ml can bind human TNFSF14 (CSB-MP023991HUj7-B), the EC50 is 15.43-18.78 ng/ml.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Activates NF-kappa-B signaling upon stimulation with lymphotoxin. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.

Reference: Salivary factor LTRIN from Aedes aegypti facilitates the transmission of Zika virus by interfering with the lymphotoxin-beta receptor. Jin L., Guo X., Shen C., Hao X., Sun P., Li P., Xu T., Hu C., Rose O., Lai R. Nat. Immunol. 19: 342-353 (2018)

Function:

View full details