Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Tumor necrosis factor receptor superfamily member 17(Tnfrsf17),partial

Recombinant Mouse Tumor necrosis factor receptor superfamily member 17(Tnfrsf17),partial

SKU:CSB-MP023974MO1

Regular price $929.00 USD
Regular price Sale price $929.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:20ug. Other sizes are also available. For further information, please contact us.

Research Areas:Cancer

Uniprot ID:O88472

Gene Names:Tnfrsf17

Organism:Mus musculus (Mouse)

AA Sequence:MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Expression Region:1-54aa

Sequence Info:Partial

Source:Mammalian cell

Tag Info:C-terminal hFc-tagged

MW:34.8 kDa

Alternative Name(s):B-cell maturation protein (CD_antigen: CD269) (Bcm) (Bcma)

Relevance:Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK.

Reference:"BCMA is essential for the survival of long-lived bone marrow plasma cells." O'Connor B.P., Raman V.S., Erickson L.D., Cook W.J., Weaver L.K., Ahonen C., Lin L.L., Mantchev G.T., Bram R.J., Noelle R.J. J. Exp. Med. 199:91-98(2004)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:18-28 business days

View full details