Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Tumor necrosis factor ligand superfamily member 4(Tnfsf4)

Recombinant Mouse Tumor necrosis factor ligand superfamily member 4(Tnfsf4)

SKU:CSB-CF023994MO

Regular price $1,803.00 USD
Regular price Sale price $1,803.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P43488

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEGEGVQPLDENLENGSRPRFKWKKTLRLVVSGIKGAGMLLCFIYVCLQLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL

Protein Names:Recommended name: Tumor necrosis factor ligand superfamily member 4 Alternative name(s): OX40 ligand Short name= OX40L CD_antigen= CD252

Gene Names:Name:Tnfsf4 Synonyms:Ox40l, Txgp1l

Expression Region:1-198

Sequence Info:full length protein

View full details