Gene Bio Systems
Recombinant Mouse Tumor necrosis factor ligand superfamily member 4(Tnfsf4)
Recombinant Mouse Tumor necrosis factor ligand superfamily member 4(Tnfsf4)
SKU:CSB-CF023994MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:P43488
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEGEGVQPLDENLENGSRPRFKWKKTLRLVVSGIKGAGMLLCFIYVCLQLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
Protein Names:Recommended name: Tumor necrosis factor ligand superfamily member 4 Alternative name(s): OX40 ligand Short name= OX40L CD_antigen= CD252
Gene Names:Name:Tnfsf4 Synonyms:Ox40l, Txgp1l
Expression Region:1-198
Sequence Info:full length protein
