
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein: Ttr
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Mus musculus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: P07309
AA Sequence: AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
Tag info: NO-tagged
Expression Region: 23-147aa
Protein length: Partial
MW: 13.5 kDa
Alternative Name(s): Prealbumin
Relevance: Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.
Reference: "Structural comparisons between mouse and human prealbumin." Wakasugi S., Maeda S., Shimada K., Nakashima H., Migita S. J. Biochem. 98:1707-1714(1985)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Transthyretin(Ttr),partial
- Regular price
- $972.00 USD
- Sale price
- $972.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Transthyretin(Ttr),partial
- Regular price
- $979.00 USD
- Sale price
- $979.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Transthyretin(Ttr),partial
- Regular price
- $972.00 USD
- Sale price
- $972.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Transthyretin(Ttr),partial
- Regular price
- $972.00 USD
- Sale price
- $972.00 USD
- Regular price
-
- Unit price
- per
Sold out