Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Thyroid hormone-inducible hepatic protein(Thrsp)

Recombinant Mouse Thyroid hormone-inducible hepatic protein(Thrsp)

SKU:CSB-EP726789MO

Regular price $963.00 USD
Regular price Sale price $963.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: Q62264

Gene Names: Thrsp

Organism: Mus musculus (Mouse)

AA Sequence: MQVLTKRYPKNCLLTVMDRYSAVVRNMEQVVMIPSLLRDVQLSGPGGSVQDGAPDLYTYFTMLKSICVEVDHGLLPREEWQAKVAGNETSEAENDAAETEEAEEDRISEELDLEAQFHLHFCSLHHILTHLTRKAQEVTRKYQEMTGQVL

Expression Region: 1-150aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 33.1 kDa

Alternative Name(s): Spot 14 protein Short name: S14 Short name: SPOT14

Relevance: Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA. May function as transcriptional coactivator. May modulate the transcription factor activity of THRB

Reference: "Cloning and initial characterization of human and mouse Spot 14 genes."Grillasca J.-P., Gastaldi M., Khiri H., Dace A., Peyrol N., Reynier P., Torresani J., Planells R.FEBS Lett. 401:38-42(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details