Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Thymosin beta-10(Tmsb10)

Recombinant Mouse Thymosin beta-10(Tmsb10)

SKU:CSB-EP765096MO

Regular price $1,018.00 USD
Regular price Sale price $1,018.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Signal Transduction

Uniprot ID:Q6ZWY8

Gene Names:Tmsb10

Organism:Mus musculus (Mouse)

AA Sequence:ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS

Expression Region:2-44aa

Sequence Info:Full Length of Mature Protein

Source:E.coli

Tag Info:N-terminal 6xHis-SUMO-tagged

MW:17.8 kDa

Alternative Name(s):Tmsb10;Ptmb10

Relevance:Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization (By similarity).

Reference:"Fetal and trophoblast PI3K p110alpha have distinct roles in regulating resource supply to the growing fetus in mice." Lopez-Tello J., Perez-Garcia V., Khaira J., Kusinski L.C., Cooper W.N., Andreani A., Grant I., Fernandez de Liger E., Lam B.Y., Hemberger M., Sandovici I., Constancia M., Sferruzzi-Perri A.N. Elife 8:0-0(2019)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details