Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse T-cell immunoreceptor with Ig and ITIM domains(Tigit)

Recombinant Mouse T-cell immunoreceptor with Ig and ITIM domains(Tigit)

SKU:CSB-CF023545MO

Regular price $1,884.00 USD
Regular price Sale price $1,884.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P86176

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSDDRNGLAQFQTAPLGGTMAAVLGLICLMVTGVTVLARKDKSIRMHSIESGLGRTEAEPQEWNLRSLSSPGSPVQTQTAPAGPCGEQAEDDYADPQEYFNVLSYRSLESFIAVSKTG

Protein Names:Recommended name: T-cell immunoreceptor with Ig and ITIM domains Alternative name(s): V-set and transmembrane domain-containing protein 3

Gene Names:Name:Tigit Synonyms:Vstm3

Expression Region:29-249

Sequence Info:full length protein

View full details