Recombinant Mouse Syndecan-2(Sdc2)

SKU: CSB-CF020889MO

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P43407

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ETRTELTSDKDMYLDNSSIEEASGVYPIDDDDYSSASGSGADEDIESPVLTTSQLIPRIPLTSAASPKVETMTLKTQSITPAQTESPEETDKEEVDISEAEEKLGPAIKSTDVYTEKHSDNLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA

Protein Names:Recommended name: Syndecan-2 Short name= SYND2 Alternative name(s): Fibroglycan Heparan sulfate proteoglycan core protein Short name= HSPG CD_antigen= CD362

Gene Names:Name:Sdc2 Synonyms:Hspg1, Synd2

Expression Region:19-202

Sequence Info:full length protein