Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Survival motor neuron protein(Smn1)

Recombinant Mouse Survival motor neuron protein(Smn1)

SKU:CSB-BP021838MO

Regular price $730.00 USD
Regular price Sale price $730.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 25-35 working days

Research Topic: Epigenetics and Nuclear Signaling

Uniprot ID: P97801

Gene Names: Smn1

Organism: Mus musculus (Mouse)

AA Sequence: MAMGSGGAGSEQEDTVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETPDKPKGTARRKPAKKNKSQKKNATTPLKQWKVGDKCSAVWSEDGCIYPATITSIDFKRETCVVVYTGYGNREEQNLSDLLSPTCEVANSTEQNTQENESQVSTDDSEHSSRSLRSKAHSKSKAAPWTSFLPPPPPMPGSGLGPGKPGLKFNGPPPPPPLPPPPFLPCWMPPFPSGPPIIPPPPPISPDCLDDTDALGSMLISWYMSGYHTGYYMGFRQNKKEGKCSHTN

Expression Region: 1-288aa

Sequence Info: Full Length

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 35.3 kDa

Alternative Name(s): Smn

Relevance: The SMN complex plays a catalyst role in the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assembly of core snRNPs and their transport to the nucleus. Ensures the correct splicing of U12 intron-containing genes that may be important for normal motor and proprioceptive neurons development. Also required for resolving RNA-DNA hybrids created by RNA polymerase II, that form R-loop in transcription terminal regions, an important step in proper transcription termination. May also play a role in the metabolism of small nucleolar ribonucleoprotein (snoRNPs).

Reference: "Inactivation of the survival motor neuron gene, a candidate gene for human spinal muscular atrophy, leads to massive cell death in early mouse embryos." Schrank B., Goetz R., Gunnersen J.M., Ure J.M., Toyka K.V., Smith A.G., Sendtner M. Proc. Natl. Acad. Sci. U.S.A. 94:9920-9925(1997)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details