Gene Bio Systems
Recombinant Mouse Superoxide dismutase [Cu-Zn](Sod1)
Recombinant Mouse Superoxide dismutase [Cu-Zn](Sod1)
SKU:CSB-YP022397MO
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P08228
Gene Names: Sod1
Organism: Mus musculus (Mouse)
AA Sequence: AMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSKKHGGPADEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Expression Region: 2-154aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 17.8 kDa
Alternative Name(s):
Relevance: Destroys radicals which are normally produced within the cells and which are toxic to biological systs.
Reference: SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_272080d8-8d22-4894-b252-8affe390948f.jpg?v=1659196075&width=1445)