Recombinant Mouse Sodium-potassium-transporting ATPase subunit gamma(Fxyd2)

SKU: CSB-CF009090MO

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q04646

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGEISDLSANSGGSAKGTENPFEYDYETVRKGGLIFAGLAFVVGLLIILSKRFRCGGGK KHRQVNEDEL

Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit gamma Short name= Na(+)/K(+) ATPase subunit gamma Alternative name(s): FXYD domain-containing ion transport regulator 2 Sodium pump gamma chain

Gene Names:Name:Fxyd2 Synonyms:Atp1c, Atp1g1

Expression Region:1-70

Sequence Info:Full length protein