Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Serum amyloid A-3 protein(Saa3)

Recombinant Mouse Serum amyloid A-3 protein(Saa3)

SKU:CSB-YP361411MO

Regular price $957.00 USD
Regular price Sale price $957.00 USD
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: Saa3

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: P04918

AA Sequence: RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY

Tag info: N-terminal 6xHis-tagged

Expression Region: 20-122aa

Protein length: Full Length of Mature Protein

MW: 13.8 kDa

Alternative Name(s):

Relevance: Major acute phase reactant. Apolipoprotein of the HDL complex.

Reference: The sequence and structure of a new serum amyloid A gene.Stearman R.S., Lowell C.A., Peltzman C.G., Morrow J.F.Nucleic Acids Res. 14:797-809(1986)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details