Gene Bio Systems
Recombinant Mouse Serine protease hepsin(Hpn)
Recombinant Mouse Serine protease hepsin(Hpn)
SKU:CSB-CF010704MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:O35453
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAKEDEEPGAHRGGSTCSRPQPGKGGRTAACCSRPKVAALIVGTLLFLTGIGAASWAIVTILLQSDQEPLYQVQLSPGDSRLAVFDKTEGTWRLLCSSRSNARVAGLGCEEMGFLRALAHSELDVRTAGANGTSGFFCVDEGGLPLAQRLLDVISVCDCPRGRFLTATCQDCGRRKLPVDR
Protein Names:Recommended name: Serine protease hepsin EC= 3.4.21.106 Cleaved into the following 2 chains: 1. Serine protease hepsin non-catalytic chain 2. Serine protease hepsin catalytic chain
Gene Names:Name:Hpn
Expression Region:1-181
Sequence Info:full length protein
