Recombinant Mouse Serine protease 29(Prss29)

Recombinant Mouse Serine protease 29(Prss29)

CSB-EP859566MO
Regular price
$677.00 USD
Sale price
$677.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cancer

Uniprot ID: Q99MS4

Gene Names: Prss29

Organism: Mus musculus (Mouse)

AA Sequence: GTPAPGPEDVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYHNATRHRNRGQKLILKDMLCAGNQGQDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALRDFPGVYARVQSFLPWITQQMQRFS

Expression Region: 18-279aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 45.1 kDa

Alternative Name(s): Implantation serine proteinase 2 Isp2

Relevance: Involved in embryo hatching and implantation.

Reference: "Regulation of the strypsin-related proteinase ISP2 by progesterone in endometrial gland epithelium during implantation in mice." O'Sullivan C.M., Liu S.Y., Rancourt S.L., Rancourt D.E. Reproduction 122:235-244(2001)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.