Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Protein TEX261(Tex261)

Recombinant Mouse Protein TEX261(Tex261)

SKU:CSB-CF714017MO

Regular price $1,798.00 USD
Regular price Sale price $1,798.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q62302

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MWFMYVLSWLSLFIQVAFITLAVAAGLYYLAELIEEYTVATSRIIKYMIWFSTAVLIGLY VFERFPTSMIGVGLFTNLVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLAFQFFAEEYY PFSEVLAYFTFCLWIIPFAFFVSLSAGENVLPSTMQPGDDVVSNYFTKGKRGKRLGILVV FSFIKEAILPSRQKIY

Protein Names:Recommended name: Protein TEX261 Alternative name(s): Testis-expressed protein 261 Testis-expressed sequence 261 protein

Gene Names:Name:Tex261

Expression Region:1-196

Sequence Info:full length protein

View full details