Recombinant Mouse Protein NDNF (Ndnf)

SKU: Q8C119

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Neuroscience

Uniprot ID: Q8C119

Gene Names: Ndnf

Alternative Name(s): Epidermacan;Neuron-derived neurotrophic factor

Abbreviation: Recombinant Mouse Ndnf protein

Organism: Mus musculus (Mouse)

Source: E.coli

Expression Region: 20-568aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: QKLPTRDEELFQMQIRDKEFFHDSSVIPDGAEVSSYLFRDTPRRYFFMVEEDNTPLSVTVTPCDAPLEWKLSLQELHEGSSADGSGDPELLDQQKQQMTDVEGTELFSYKGNDVEYFLSSSSPSGLYQLELLSTEKDTHFKVYATTTPESDQPYPELPYDPRVDVTSFGRTTVTLAWKPSPTASILKQPIEYCVVINKEHNFKSLCAAETKMNADDAFMVAPKPGLDFNPFDFAHFGFPTDNLGKDRSLLAKPSPKVGRHVYWRPKVDIQKICIGNKNIFTVSDLKPDTQYYFDVFMVNTNTNMSTAYVGAFVRTKEEAKQKTVELKDGRVTDVFVKRKGKKFLRFAPVSSHQKVTFFIHSCMDAVQVQVRRDGRLLLSQNVEGIRQFQLRGKPKGKYLIRLKGNRKGASKLKILATTRPSKHAFPSLPEDTRIKAFDKLRTCSSVTVAWLGTQERRKFCIYRKEVDGNYSEDQKRREQNQCLGPDTRKKSEKVLCKYFHSQNLQKAVTTETIRDLQPGKSYLLDVYVVGHGGHSVKYQSKIVKTRKVC

MW: 68.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Secretory protein that plays a role in various cellular processes. Acts as a chemorepellent acting on gonadotropin-releasing hormone (GnRH) expressing neurons regulating their migration to the hypothalamus. Also promotes neuron migration, growth and survival as well as neurite outgrowth and is involved in the development of the olfactory system. May also act through the regulation of growth factors activity and downstream signaling. Also regulates extracellular matrix assembly and cell adhesiveness. Promotes endothelial cell survival, vessel formation and plays an important role in the process of revascularization through NOS3-dependent mechanisms.

Reference:

Function: