Skip to product information
1 of 1

GeneBio Systems

Recombinant Mouse Protein FAM3B (Fam3b)

Recombinant Mouse Protein FAM3B (Fam3b)

SKU:Q9D309

Regular price $984.00 USD
Regular price Sale price $984.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cytokine

Uniprot ID: Q9D309

Gene Names: Fam3b

Alternative Name(s): (Cytokine-like protein 2-21)(Pancreatic-derived factor)(PANDER)

Abbreviation: Recombinant Mouse Fam3b protein

Organism: Mus musculus (Mouse)

Source: Yeast

Expression Region: 30-235aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 8xHis-tagged

Target Protein Sequence: ELIPDVPLSSTLYNIRSIGERPVLKAPAPKRQKCDHWSPCPPDTYAYRLLSGGGRDKYAKICFEDEVLIGEKTGNVARGINIAVVNYETGKVIATKYFDMYEGDNSGPMAKFIQSTPSKSLLFMVTHDDGSSKLKAQAKDAIEALGSKEIKNMKFRSSWVFVAAKGFELPSEIEREKINHSDQSRNRYAGWPAEIQIEGCIPKGLR

MW: 25.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner.

Reference: "FAM3B PANDER and FAM3C ILEI Represent a Distinct Class of Signaling Molecules with a Non-Cytokine-like Fold." Johansson P., Bernstrom J., Gorman T., Oster L., Backstrom S., Schweikart F., Xu B., Xue Y., Schiavone L.H. Structure 21: 306-313(2013)

Function:

View full details