Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Protein delta homolog 2(Dlk2),partial

Recombinant Mouse Protein delta homolog 2(Dlk2),partial

SKU:CSB-YP812967MO

Regular price $1,201.00 USD
Regular price Sale price $1,201.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Signal Transduction

Uniprot ID: Q8K1E3

Gene Names: Dlk2

Organism: Mus musculus (Mouse)

AA Sequence: DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTSQSPCQNGGQCVYDGGGEYHCVCLPGFHGRGCERKAGPCEQAGFPCRNGGQCQDNQGFALNFTCRCLAGFMGAHCEVNVDDCLMRPCANGATCIDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPAPEPASVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQESGLGESS

Expression Region: 27-305aa

Sequence Info: Extracellular Domain

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 31.6 kDa

Alternative Name(s): Endothelial cell-specific protein S-1 Epidermal growth factor-like protein 9 Short name: EGF-like protein 9

Relevance: Regulates adipogenesis.

Reference: "The novel gene EGFL9/Dlk2, highly homologous to Dlk1, functions as a modulator of adipogenesis."Nueda M.L., Baladron V., Garcia-Ramirez J.J., Sanchez-Solana B., Ruvira M.D., Rivero S., Ballesteros M.A., Monsalve E.M., Diaz-Guerra M.J., Ruiz-Hidalgo M.J., Laborda J.J. Mol. Biol. 367:1270-1280(2007)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details