Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Proprotein convertase subtilisin-kexin type 5(Pcsk5),partial

Recombinant Mouse Proprotein convertase subtilisin-kexin type 5(Pcsk5),partial

SKU:CSB-YP017644MO

Regular price $958.00 USD
Regular price Sale price $958.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: Q04592

Gene Names: Pcsk5

Organism: Mus musculus (Mouse)

AA Sequence: DYDLSHAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAATANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSYNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAE

Expression Region: 117-452aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 38.7 kDa

Alternative Name(s): Proprotein convertase 5 Short name: PC5 Proprotein convertase 6 Short name: PC6 Subtilisin-like proprotein convertase 6 Short name: SPC6 Subtilisin/kexin-like protease PC5

Relevance: Plays an essential role in pregnancy establishment by proteolytic activation of a number of important factors such as BMP2, CALD1 and alpha-integrins. Likely to represent a widespread endoprotease activity within the constitutive and regulated secretory pathway. Capable of cleavage at the RX(K/R)R consensus motif. May be responsible for the maturation of gastrointestinal peptides. May be involved in the cellular proliferation of adrenal cortex via the activation of growth factors (By similarity).

Reference: "The isoforms of proprotein convertase PC5 are sorted to different subcellular compartments."De Bie I., Marcinkiewicz M., Malide D., Lazure C., Nakayama K., Bendayan M., Seidah N.G.J. Cell Biol. 135:1261-1275(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details