Skip to product information
1 of 1

GeneBio Systems

Recombinant Mouse Prokineticin-2 (Prok2)

Recombinant Mouse Prokineticin-2 (Prok2)

SKU:Q9QXU7

Regular price $1,032.00 USD
Regular price Sale price $1,032.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cancer

Uniprot ID: Q9QXU7

Gene Names: Prok2

Alternative Name(s): (PK2)(Protein Bv8 homolog)

Abbreviation: Recombinant Mouse Prok2 protein

Organism: Mus musculus (Mouse)

Source: E.coli

Expression Region: 27-128aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 6xHis-B2M-tagged

Target Protein Sequence: AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGQVGDSCHPLTRKSHVANGRQERRRAKRRKRKKEVPFWGRRMHHTCPCLPGLACLRTSFNRFICLARK

MW: 25.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: May function as an output molecule from the suprachiasmatic nucleus (SCN) that transmits behavioral circadian rhythm. May also function locally within the SCN to synchronize output. Potently contracts gastrointestinal (GI) smooth muscle .

Reference: "Prokineticin 2 transmits the behavioural circadian rhythm of the suprachiasmatic nucleus." Cheng M.Y., Bullock C.M., Li C., Lee A.G., Bermak J.C., Belluzzi J., Weaver D.R., Leslie F.M., Zhou Q.-Y. Nature 417: 405-410(2002)

Function:

View full details