Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Probable ergosterol biosynthetic protein 28(ORF11)

Recombinant Mouse Probable ergosterol biosynthetic protein 28(ORF11)

SKU:CSB-CF875358MO

Regular price $1,730.00 USD
Regular price Sale price $1,730.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9ERY9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQARTFGIWTLLS SVIRCLCAIDIHNKTLYHITLWTFLLALGHFLSELFVFGTAAPTVGVLAPLMVASFSILG MLVGLRYLEAEPVSRQKKRN

Protein Names:Recommended name: Probable ergosterol biosynthetic protein 28

Gene Names:Name:ORF11

Expression Region:1-140

Sequence Info:full length protein

View full details