Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Probable E3 ubiquitin-protein ligase RNF144A(Rnf144a)

Recombinant Mouse Probable E3 ubiquitin-protein ligase RNF144A(Rnf144a)

SKU:CSB-CF835680MO

Regular price $1,915.00 USD
Regular price Sale price $1,915.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q925F3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTARYRPTWDLALDPLVSCKLCLGEYPAEQMTTIAQCQCIFCTLCLKQYVELLIKEGLE TAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVC QLQDIGLQTPQLVQCKACDMEFCSACKARWHPGQGCPETMPITFLPGETSSAFKMEEGDA PIKRCPKCRVYIERDEGCAQMMCKNCKHAFCWYCLESLDDDFLLIHYDKGPCRNKLGHSR ASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKCKCSKGDDDPLPT

Protein Names:Recommended name: Probable E3 ubiquitin-protein ligase RNF144A EC= 6.3.2.- Alternative name(s): RING finger protein 144A UbcM4-interacting protein 4 Ubiquitin-conjugating enzyme 7-interacting protein 4

Gene Names:Name:Rnf144a Synonyms:Kiaa0161, Rnf144, Ubce7ip4, Uip4

Expression Region:1-292

Sequence Info:full length protein

View full details