
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Neuroscience
Uniprot ID:P57774
Gene Names:Npy
Organism:Mus musculus (Mouse)
AA Sequence:YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Expression Region:29-64aa
Sequence Info:Partial
Source:Yeast
Tag Info:N-terminal hFc-tagged
MW:30.9 kDa
Alternative Name(s):Pro-neuropeptide Y [Cleaved into: Neuropeptide Y(Neuropeptide tyrosine)(NPY); C-flanking peptide of NPY(CPON)]
Relevance:NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
Reference:"Behavioral characterization of neuropeptide Y knockout mice." Bannon A.W., Seda J., Carmouche M., Francis J.M., Norman M.H., Karbon B., McCaleb M.L. Brain Res 868:79-87(2000)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:25-35 business days
You may also like
-
Recombinant Mouse Protein canopy homolog 2(Cnpy2)
- Regular price
- $899.00 USD
- Sale price
- $899.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Granzyme C(Gzmc)
- Regular price
- $899.00 USD
- Sale price
- $899.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Peptide YY(PYY),partial
- Regular price
- $610.00 USD
- Sale price
- $610.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Neuropeptide Y receptor type 2(Npy2r),partial
- Regular price
- $899.00 USD
- Sale price
- $899.00 USD
- Regular price
-
- Unit price
- per
Sold out