Recombinant Mouse Prion-like protein doppel(Prnd)

Recombinant Mouse Prion-like protein doppel(Prnd)

CSB-BP886153MO
Regular price
$451.00 USD
Sale price
$451.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 25-35 working days

Research Topic: Neuroscience

Uniprot ID: Q9QUG3

Gene Names: Prnd

Organism: Mus musculus (Mouse)

AA Sequence: RGIKHRFKWNRKVLPSSGGQITEARVAENRPGAFIKQGRKLDIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKLHQRVLWRLIKEICSAKHCDFWLERG

Expression Region: 27-155aa

Sequence Info: Full Length of Mature Protein

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 18.9 kDa

Alternative Name(s):

Relevance: Doppelganger PrPLP

Reference: "Doppel is an N-glycosylated, glycosylphosphatidylinositol-anchored protein: expression in testis and ectopic production in the brains of Prnp(0/0) mice predisposed to Purkinje cell loss." Silverman G.L., Qin K., Moore R.C., Yang Y., Mastrangelo P., Tremblay P., Prusiner S.B., Cohen F.E., Westaway D. J. Biol. Chem. 275:26834-26841(2000)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.