Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Platelet glycoprotein IX(Gp9)

Recombinant Mouse Platelet glycoprotein IX(Gp9)

SKU:CSB-CF009690MO

Regular price $1,808.00 USD
Regular price Sale price $1,808.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O88186

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TQACPRPCTCQSLETMGLKVNCEGQGLTALPVIPAHTRQLLLANNSLRSVPPGAFDHLPQLWDLDVTHNPWHCDCSLTYLRLWLEDHMPEALMHVYCASPDLATRRPLGQLTGYELGSCGWKLPPSWAYPGVWWDVSLVAVAVLGLILLAGLLNTFTESRN

Protein Names:Recommended name: Platelet glycoprotein IX Short name= GP-IX Short name= GPIX Alternative name(s): Glycoprotein 9 CD_antigen= CD42a

Gene Names:Name:Gp9

Expression Region:17-177

Sequence Info:full length protein

View full details