Gene Bio Systems
Recombinant Mouse Platelet glycoprotein Ib beta chain(Gp1bb)
Recombinant Mouse Platelet glycoprotein Ib beta chain(Gp1bb)
SKU:CSB-CF009686MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:P56400
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:PAPCSCAGTLVDCGRRGLTWASLPAAFPPDTTELVLTGNNLTALPPGLLDALPALRAAHLGANPWRCDCRLLPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYVAEDELRAACAPGLLCWGALVAQLALLVLGLLHALLLALLLGRLRRLRARARARSIQEFSLTAPLVAESARGGAS
Protein Names:Recommended name: Platelet glycoprotein Ib beta chain Short name= GP-Ib beta Short name= GPIb-beta Short name= GPIbB Alternative name(s): CD_antigen= CD42c
Gene Names:Name:Gp1bb
Expression Region:27-206
Sequence Info:full length protein
