Gene Bio Systems
Recombinant Mouse N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase(Gcnt2)
Recombinant Mouse N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase(Gcnt2)
SKU:CSB-CF009328MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:P97402
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPPSVRYFFIVSVTTVIVFIVLYVLSFGGDQSYQKLNISDSVMLAQVCSSFIDGKSRFLWRNKLMIHEKPSCTEYVTQSHYITAPLSQEEVDFPLAYVMVIHHNFDTFARLFRAIFMPQNIYCVHVDEKATAEFKGAVEQLVSCFPNAFLASKMEPVVYGGISRLQADLNCIKDLSTSEVPWKYAINTCGQDFPLKTNKEIVQYLKGLKGKNLTPGVLPPAHAIGRTRYVHREHLSKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVLRDPRAVDLLHWSKDTFSPDEHFWVTLNRIPGVPGSMPPNASWTGNLRAVKWMDMEAKHGGCHGHYVHGICIYGNGDLQWLINSQSLFANKFELNTYPLTVECLELRLRERTLNQSEIAIQPSWYF
Protein Names:Recommended name: N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase Short name= N-acetylglucosaminyltransferase EC= 2.4.1.150 Alternative name(s): I-branching enzyme IGNT Large I antigen-forming beta-1,6-N-acetylglucosaminyltransferase
Gene Names:Name:Gcnt2
Expression Region:1-401
Sequence Info:full length protein
