Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase(Gcnt2)

Recombinant Mouse N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase(Gcnt2)

SKU:CSB-CF009328MO

Regular price $2,109.00 USD
Regular price Sale price $2,109.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P97402

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPPSVRYFFIVSVTTVIVFIVLYVLSFGGDQSYQKLNISDSVMLAQVCSSFIDGKSRFLWRNKLMIHEKPSCTEYVTQSHYITAPLSQEEVDFPLAYVMVIHHNFDTFARLFRAIFMPQNIYCVHVDEKATAEFKGAVEQLVSCFPNAFLASKMEPVVYGGISRLQADLNCIKDLSTSEVPWKYAINTCGQDFPLKTNKEIVQYLKGLKGKNLTPGVLPPAHAIGRTRYVHREHLSKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVLRDPRAVDLLHWSKDTFSPDEHFWVTLNRIPGVPGSMPPNASWTGNLRAVKWMDMEAKHGGCHGHYVHGICIYGNGDLQWLINSQSLFANKFELNTYPLTVECLELRLRERTLNQSEIAIQPSWYF

Protein Names:Recommended name: N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase Short name= N-acetylglucosaminyltransferase EC= 2.4.1.150 Alternative name(s): I-branching enzyme IGNT Large I antigen-forming beta-1,6-N-acetylglucosaminyltransferase

Gene Names:Name:Gcnt2

Expression Region:1-401

Sequence Info:full length protein

View full details