Gene Bio Systems
Recombinant Mouse Mitochondrial inner membrane protease subunit 2(Immp2l)
Recombinant Mouse Mitochondrial inner membrane protease subunit 2(Immp2l)
SKU:CSB-CF806416MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q8BPT6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAQSQSWARRCFKAFCKGFFVAVPVAVTFLDRVACVARVEGSSMQPSLNPGGSQSSDVVL LNHWKVRNFEVQRGDIVSLVSPKNPEQKIIKRVIALEGDIVRTIGHKNRLVKVPRGHMWV EGDHHGHSFDSNSFGPVSLGLLHAHATHILWPPERWQRLESVLPPERCPLQTGEK
Protein Names:Recommended name: Mitochondrial inner membrane protease subunit 2 EC= 3.4.21.- Alternative name(s): IMP2-like protein
Gene Names:Name:Immp2l
Expression Region:1-175
Sequence Info:full length protein
